Managers for hire in Sweden
Showing 11 results
Sponsored Freelancers
-
I am an International Business Management Expert with expertise in various areas such as business management, process improvement, system analysis, and project management. I have a Master's in Business Administration focused on International business, which gives me a unique skill set to drive growth and success in...I am an International Business Management Expert with expertise in various areas such as business management, process improvement, system analysis, and project management. I have a Master's in Business Administration focused on International business, which gives me a unique skill set to drive growth and success in the global market. I am skilled at identifying inefficiencies and implementing strategies to enhance productivity and reduce costs through process improvement. I ensure optimal functionality and seamless operations within organizations through in-depth system analysis. With my deep understanding of consumer behavior and market trends, I develop effective marketing strategies to promote brand awareness and increase revenue. My experience in project management allows me to successfully plan, execute, and oversee complex initiatives, managing teams, resources, and budgets to deliver high-quality results on time. My expertise in buying and selling helps me navigate the complexities of international trade, including market research, negotiations, and customs clearance. I also have skills in document production, administrative management, research, client care management, problem-solving, networking, and relationship building, focusing on providing legendary client service. I am experienced in acquiring new clients and improving processes. less
Hire Elham1375
-
2018 - 2021: Management Assistant at All Access Scandinavia Ltd In this role, I excelled in providing proactive support to executive teams, streamlining their daily operations and long-term business strategies. My responsibilities included: Anticipating and addressing the needs of the management team, offering...2018 - 2021: Management Assistant at All Access Scandinavia Ltd In this role, I excelled in providing proactive support to executive teams, streamlining their daily operations and long-term business strategies. My responsibilities included: Anticipating and addressing the needs of the management team, offering support in scheduling, document preparation, and information gathering. Efficiently managing executive calendars, scheduling meetings, and handling correspondence. Organizing company events and meetings, ensuring seamless execution and a welcoming environment. Safeguarding confidential information with the highest discretion. Coordinating comprehensive travel arrangements for business trips. Overseeing office supplies inventory and managing procurement processes. 2010 - 2017: Administrative Assistant at All Access Scandinavia Ltd In this earlier role, I provided comprehensive administrative support to senior executives, contributing significantly to the office's smooth functioning. My key tasks included: Managing executives' calendars, prioritizing tasks, and resolving scheduling conflicts. Preparing and managing expense reports, adhering to company policies, and using templates for efficient tracking. Coordinating team meetings and events, from planning to execution, including venue selection, material preparation, and on-site coordination. Managing general office operations, including reception duties, correspondence handling, and document management. Overseeing office maintenance, supplies inventory, and coordinating with service providers. Ensuring compliance with health and safety regulations and assisting in developing office policies and procedures. Additional Proficiencies and Achievements: Renowned for autonomous task management and operational efficiency, with a proven ability to meet critical deadlines. Proven expertise in email management and appointment scheduling, with a focus on inbox optimization and effective time management. Advanced data entry skills and Excel proficiency, adept at creating data-driven spreadsheets, utilizing analytical formulas, and generating insightful reports for strategic decision-making. Renowned for meticulous attention to detail, ensuring data accuracy and reliability. My tenure at All Access Scandinavia Ltd has endowed me with a comprehensive skill set in administrative and management support, making me highly capable in managing diverse tasks in a dynamic environment. I am eager to bring my expertise to your team and contribute significantly to your organizational goals. less
Hire Samhus2020
-
A hardworking and passionate business management professional with proven leadership, organizational, and product development skills. Solid experience and select strengths that encompass management, staff training, and team leadership. Bringing over 7+ years of extensive background in marketing, business development,...A hardworking and passionate business management professional with proven leadership, organizational, and product development skills. Solid experience and select strengths that encompass management, staff training, and team leadership. Bringing over 7+ years of extensive background in marketing, business development, business intelligence, finance, operations management, customer service, advertising, and event production. Consistently, reaching revenue and sales goals bringing a high level of productivity, profitability, leadership, and passion to your organization. Adept in managing staff, maintenance, vendors, and a multitude of business operations. less
Hire Hastyarhasaly
-
Several years in banking, highly educated and great at business, finance, marketing and writing. I am looking for work in different areas within these subjects.Several years in banking, highly educated and great at business, finance, marketing and writing. I am looking for work in different areas within these subjects. less
Hire eliarita2
-
We are experience dynamic Full Stack Developers based in Sweden. We value quality and we are also time conscious. Our specialty are Boostrap, node.js, React, Database, HTML, CSS. JavaScript, SQL , noSQL and React nativeWe are experience dynamic Full Stack Developers based in Sweden. We value quality and we are also time conscious. Our specialty are Boostrap, node.js, React, Database, HTML, CSS. JavaScript, SQL , noSQL and React native less
Hire kwangmart12
-
I enjoy getting business done, I am interested in creative writing and translations. I can Teach Arabic. I have a wonderful experience in managementI enjoy getting business done, I am interested in creative writing and translations. I can Teach Arabic. I have a wonderful experience in management less
Hire dema46
-
I am an Economist, with experience as a CFO, Board Member and Business Developer, with an ambition for driving impactful change and setting new standards in every venture. Results and goal-driven, I'm committed to not just meeting, but consistently surpassing organizational objectives. With a strong passion for sales...I am an Economist, with experience as a CFO, Board Member and Business Developer, with an ambition for driving impactful change and setting new standards in every venture. Results and goal-driven, I'm committed to not just meeting, but consistently surpassing organizational objectives. With a strong passion for sales and increasing revenue, I aim to set new standards through strategic vision and hands-on expertise. less
Hire NIkolaosTsakiris
-
By profession, I'm an IT Engineer, but my true passion lies in sales. A headhunter discovered this during an unrelated interview, sparking my 10+ year journey in the commercial sector. I've consistently helped companies increase sales and cultivate high customer loyalty. My proficiency in technological tools, coupled...By profession, I'm an IT Engineer, but my true passion lies in sales. A headhunter discovered this during an unrelated interview, sparking my 10+ year journey in the commercial sector. I've consistently helped companies increase sales and cultivate high customer loyalty. My proficiency in technological tools, coupled with my sales expertise, adds significant value. Among my achievements, I successfully launched products and services in new markets across diverse sectors (logistics, manufacturing, healthcare, retail) in over 6 countries. Furthermore, I possess expertise in leveraging office tools like Microsoft Office, Google Suite, and Salesforce to streamline sales management and customer communication. Additionally, I have experience managing social media platforms like Facebook, LinkedIn, and Twitter to craft and execute digital marketing campaigns that attract new clients and retain existing ones. Finally, I'm familiar with applying artificial intelligence in sales, including utilizing chatbots for customer service, segmenting potential leads, and automating tasks. Personally, I'm a tech enthusiast and a self-taught expert in building gaming computers. I find peace while walking and listening to relevant podcasts. I'm confident my skills and experience can significantly benefit your company. less
Hire Juandagarces
-
Rbbfkdidkejejeueudjhdvdbdhsvdvd heudkendjdkdnndldldnfkfkfkjfrkrnnrndndndndnndnndndndndndndndmndkdlepwpwkRbbfkdidkejejeueudjhdvdbdhsvdvd heudkendjdkdnndldldnfkfkfkjfrkrnnrndndndndnndnndndndndndndndmndkdlepwpwk less
Hire Steveswe
-
Over the years, I've realized that the world of programming is vast and ever-evolving, with countless opportunities to expand my knowledge and skills. As a dedicated coder, I'm constantly on the lookout for new programming languages, frameworks, and technologies to explore. My journey began with learning basic...Over the years, I've realized that the world of programming is vast and ever-evolving, with countless opportunities to expand my knowledge and skills. As a dedicated coder, I'm constantly on the lookout for new programming languages, frameworks, and technologies to explore. My journey began with learning basic languages like HTML, CSS, and JavaScript. Gradually, I delved into the world of back-end development, mastering languages like Python, Ruby, and PHP. As I progressed, I also became interested in mobile application development, which led me to learn languages such as Swift and Kotlin. To stay up-to-date with the latest developments in the tech world, I make it a point to regularly participate in online forums, attend conferences, and engage with other developers. These interactions not only keep me informed about emerging trends but also provide a platform for exchanging ideas and best practices. Recently, I have been intrigued by the growing popularity of machine learning and artificial intelligence. I decided to venture into this fascinating domain by learning Python libraries like TensorFlow, PyTorch, and scikit-learn. These powerful tools have allowed me to develop a deeper understanding of data analysis, natural language processing, and computer vision techniques. As part of my ongoing quest to learn new things, I've also started exploring the world of blockchain and decentralized applications. Learning languages like Solidity and platforms like Ethereum has broadened my perspective on how we can leverage technology to create secure and transparent systems. In order to maintain my motivation and excitement for learning, I often participate in hackathons and coding competitions. These events challenge me to push my boundaries and develop innovative solutions under tight deadlines. They also provide valuable networking opportunities and help me build connections with like-minded individuals who share my passion for coding. Furthermore, I believe in giving back to the community that has nurtured my growth. I dedicate some of my time to mentoring aspiring programmers and contributing to open-source projects. This not only allows me to hone my skills but also instills a sense of fulfillment as I help others on their coding journey. In conclusion, my life passion for coding and the insatiable desire to learn new things drives me to continually expand my knowledge and skills. I'm eager to see what the future holds for the world of technology, and I'm confident that my commitment to lifelong learning will allow me to adapt and thrive in this ever-changing landscape. less
Hire MiladZarour
